SCOP 1.59: Domain d2rtnb_: 2rtn B:

Lineage for d2rtnb_ (2rtn B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d2rtnb_: 2rtn B: [27387]

Details for d2rtnb_

PDB Entry: 2rtn, 1.8 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 2.0, space group i222

SCOP Domain Sequences for d2rtnb_:

Sequence; same for both SEQRES and ATOM records:

>d2rtnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtnb_:

• d2rtnb_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtnb_ appears in SCOP 1.57
  
• d2rtnb_ appears in SCOP 1.61
  
• d2rtnb_ appears in the current release, SCOPe 2.08