Lineage for d4qzda1 (4qzd A:147-242)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716133Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2716134Protein automated matches [254482] (3 species)
    not a true protein
  7. 2716153Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries)
  8. 2716180Domain d4qzda1: 4qzd A:147-242 [273701]
    Other proteins in same PDB: d4qzda2, d4qzda3
    automated match to d1jmsa1
    protein/DNA complex; complexed with dct, mg, na; mutant

Details for d4qzda1

PDB Entry: 4qzd (more details), 2.7 Å

PDB Description: mouse tdt, f405a mutant, in complex with a dsb substrate, c-c base pair
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4qzda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzda1 a.60.6.0 (A:147-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpit
smkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d4qzda1:

Click to download the PDB-style file with coordinates for d4qzda1.
(The format of our PDB-style files is described here.)

Timeline for d4qzda1: