SCOPe 2.08: Domain d1swkb_: 1swk B:

Lineage for d1swkb_ (1swk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1swkb_: 1swk B: [27366]
   complexed with btn, btq; mutant

Details for d1swkb_

PDB Entry: 1swk, 2 Å

PDB Description: core-streptavidin mutant w79f in complex with biotin at ph 4.5

PDB Compounds: (B:) core-streptavidin

SCOPe Domain Sequences for d1swkb_:

Sequence; same for both SEQRES and ATOM records:

>d1swkb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvafknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

Timeline for d1swkb_:

• d1swkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1swkb_ appears in SCOPe 2.07