Lineage for d4zv3b2 (4zv3 B:222-371)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551515Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries)
  8. 2551533Domain d4zv3b2: 4zv3 B:222-371 [273599]
    automated match to d2v1ob_
    complexed with coa

Details for d4zv3b2

PDB Entry: 4zv3 (more details), 3.1 Å

PDB Description: crystal structure of the n- and c-terminal domains of mouse acyl-coa thioesterase 7
PDB Compounds: (B:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d4zv3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zv3b2 d.38.1.0 (B:222-371) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pepntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvda
infhdkirkgcvitisgrmtftsnksmeievlvdadpvvdnsqkryraasafftyvslnq
egkpmpvpqlvpetedekkrfeegkgrylq

SCOPe Domain Coordinates for d4zv3b2:

Click to download the PDB-style file with coordinates for d4zv3b2.
(The format of our PDB-style files is described here.)

Timeline for d4zv3b2: