Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Paenibacillus barcinonensis [TaxId:198119] [273460] (1 PDB entry) |
Domain d4w8la_: 4w8l A: [273462] automated match to d3mmda_ complexed with ca, gol |
PDB Entry: 4w8l (more details), 1.76 Å
SCOPe Domain Sequences for d4w8la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w8la_ c.1.8.0 (A:) automated matches {Paenibacillus barcinonensis [TaxId: 198119]} nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn
Timeline for d4w8la_: