SCOP 1.59: Domain d1swoa_: 1swo A:

Lineage for d1swoa_ (1swo A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d1swoa_: 1swo A: [27346]

Details for d1swoa_

PDB Entry: 1swo, 1.95 Å

PDB Description: core-streptavidin mutant w120f at ph 7.5

SCOP Domain Sequences for d1swoa_:

Sequence; same for both SEQRES and ATOM records:

>d1swoa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanafkstlvghdtftkvkp

Timeline for d1swoa_:

• d1swoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1swoa_ appears in SCOP 1.57
  
• d1swoa_ appears in SCOP 1.61
  
• d1swoa_ appears in the current release, SCOPe 2.08