Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d4y4ff_: 4y4f F: [273243] Other proteins in same PDB: d4y4fa1, d4y4fa2, d4y4fc1, d4y4fc2, d4y4fd1, d4y4fd2, d4y4fe1, d4y4fe2, d4y4fg1, d4y4fg2, d4y4fh1, d4y4fh2 automated match to d3gmob_ complexed with 49m, nag |
PDB Entry: 4y4f (more details), 3.19 Å
SCOPe Domain Sequences for d4y4ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4ff_ b.1.1.2 (F:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdr
Timeline for d4y4ff_: