Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (16 PDB entries) |
Domain d4pngb2: 4png B:88-223 [273126] Other proteins in same PDB: d4pnga1, d4pngb1 automated match to d4hi7b2 complexed with gsf |
PDB Entry: 4png (more details), 1.53 Å
SCOPe Domain Sequences for d4pngb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pngb2 a.45.1.0 (B:88-223) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} kdllqravvdqrlhfesgvifanalrsitkplfagkqtmipkerydaiievydflekfla gndyvagnqltiadfsiistvsslevfvkvdttkypriaawfkrlqklpyyeeangngar tfesfireynftfasn
Timeline for d4pngb2: