Lineage for d4ylga_ (4ylg A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476201Species Entamoeba histolytica [TaxId:294381] [273048] (1 PDB entry)
  8. 2476202Domain d4ylga_: 4ylg A: [273050]
    automated match to d3aq4a_
    complexed with gdp, mg

Details for d4ylga_

PDB Entry: 4ylg (more details), 1.8 Å

PDB Description: structure of an adp ribosylation factor from entamoeba histolytica hm- 1:imss bound to mg-gdp
PDB Compounds: (A:) ADP-ribosylation factor

SCOPe Domain Sequences for d4ylga_:

Sequence, based on SEQRES records: (download)

>d4ylga_ c.37.1.8 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan
khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl

Sequence, based on observed residues (ATOM records): (download)

>d4ylga_ c.37.1.8 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvgglwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpq
amsisevteklglqtiknrkwycqtscatngdglyegldwladnl

SCOPe Domain Coordinates for d4ylga_:

Click to download the PDB-style file with coordinates for d4ylga_.
(The format of our PDB-style files is described here.)

Timeline for d4ylga_: