SCOPe 2.08: Domain d1srgb_: 1srg B:

Lineage for d1srgb_ (1srg B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1srgb_: 1srg B: [27304]
   complexed with mhb

Details for d1srgb_

PDB Entry: 1srg, 1.8 Å

PDB Description: structure-based design of synthetic azobenzene ligands for streptavidin

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1srgb_:

Sequence, based on SEQRES records:

>d1srgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records):

>d1srgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapasgtalgwtv
awknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1srgb_:

• d1srgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1srgb_ appears in SCOPe 2.07