SCOPe 2.07: Domain d2rufa1: 2ruf A:6-121

Lineage for d2rufa1 (2ruf A:6-121)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein automated matches [254585] (1 species)
   not a true protein

7. Species Fungus (Humicola insolens) [TaxId:34413] [255369] (4 PDB entries)

8. Domain d2rufa1: 2ruf A:6-121 [272982]
   Other proteins in same PDB: d2rufa2
   automated match to d2kp1a_

Details for d2rufa1

PDB Entry: 2ruf

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide (reduced form, 303k)

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2rufa1:

Sequence; same for both SEQRES and ATOM records:

>d2rufa1 c.47.1.2 (A:6-121) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

Timeline for d2rufa1:

• d2rufa1 first appeared in SCOPe 2.05, called d2rufa_
  
• d2rufa1 appears in SCOPe 2.06
  
• d2rufa1 appears in the current release, SCOPe 2.08