SCOP 1.59: Domain d2rtpb_: 2rtp B:

Lineage for d2rtpb_ (2rtp B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d2rtpb_: 2rtp B: [27272]

Details for d2rtpb_

PDB Entry: 2rtp, 1.5 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 3.25, space group i222

SCOP Domain Sequences for d2rtpb_:

Sequence; same for both SEQRES and ATOM records:

>d2rtpb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtpb_:

• d2rtpb_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtpb_ appears in SCOP 1.57
  
• d2rtpb_ appears in SCOP 1.61
  
• d2rtpb_ appears in the current release, SCOPe 2.08