Lineage for d4pc2a3 (4pc2 A:297-393)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403547Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2403548Protein automated matches [254425] (18 species)
    not a true protein
  7. 2403566Species Escherichia coli [TaxId:316385] [272317] (3 PDB entries)
  8. 2403571Domain d4pc2a3: 4pc2 A:297-393 [272341]
    Other proteins in same PDB: d4pc2a1, d4pc2a2, d4pc2b1, d4pc2b2, d4pc2c1, d4pc2c2, d4pc2c3, d4pc2d1, d4pc2d2, d4pc2d3
    automated match to d1d8ta2
    complexed with cl, gdp, gol

Details for d4pc2a3

PDB Entry: 4pc2 (more details), 2.2 Å

PDB Description: elongation factor tu:ts complex with a bound gdp
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4pc2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pc2a3 b.44.1.0 (A:297-393) automated matches {Escherichia coli [TaxId: 316385]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4pc2a3:

Click to download the PDB-style file with coordinates for d4pc2a3.
(The format of our PDB-style files is described here.)

Timeline for d4pc2a3: