Lineage for d5afne_ (5afn E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428908Protein automated matches [190922] (2 species)
    not a true protein
  7. 2428909Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (35 PDB entries)
  8. 2429079Domain d5afne_: 5afn E: [272147]
    automated match to d1uw6a_
    complexed with bma, gol, l0b, man, nag, ojd

Details for d5afne_

PDB Entry: 5afn (more details), 2.15 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 5
PDB Compounds: (E:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afne_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afne_:

Click to download the PDB-style file with coordinates for d5afne_.
(The format of our PDB-style files is described here.)

Timeline for d5afne_: