Lineage for d1erxa_ (1erx A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1551946Protein Nitrophorin 4 [50845] (1 species)
  7. 1551947Species Rhodnius prolixus [TaxId:13249] [50846] (44 PDB entries)
    Uniprot Q94734 22-205
  8. 1551983Domain d1erxa_: 1erx A: [27164]
    complexed with cit, hev, no

Details for d1erxa_

PDB Entry: 1erx (more details), 1.4 Å

PDB Description: crystal structure of nitrophorin 4 complexed with no
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1erxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erxa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1erxa_:

Click to download the PDB-style file with coordinates for d1erxa_.
(The format of our PDB-style files is described here.)

Timeline for d1erxa_: