Lineage for d4ttsa2 (4tts A:204-308)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404122Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2404123Protein automated matches [227053] (7 species)
    not a true protein
  7. 2404149Species Zebrafish (Danio rerio) [TaxId:7955] [271467] (6 PDB entries)
  8. 2404152Domain d4ttsa2: 4tts A:204-308 [271514]
    Other proteins in same PDB: d4ttsa1
    automated match to d2bw0a1
    complexed with 6dd

Details for d4ttsa2

PDB Entry: 4tts (more details), 2 Å

PDB Description: crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (y200a) complex with 10-formyl-5,8-dideazafolate
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d4ttsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttsa2 b.46.1.0 (A:204-308) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
qkkenskidwnqpaeaihnwirgndrvpgawaeidgksvsfygstllendhfssngqple
ipgasraalvtknglvlfgndgkmllvknlqfedgkmipgsqyfk

SCOPe Domain Coordinates for d4ttsa2:

Click to download the PDB-style file with coordinates for d4ttsa2.
(The format of our PDB-style files is described here.)

Timeline for d4ttsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ttsa1