Lineage for d4tt8a1 (4tt8 A:1-203)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500328Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2500329Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2500330Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2500431Protein automated matches [227063] (3 species)
    not a true protein
  7. 2500439Species Zebrafish (Danio rerio) [TaxId:7955] [271465] (6 PDB entries)
  8. 2500446Domain d4tt8a1: 4tt8 A:1-203 [271509]
    Other proteins in same PDB: d4tt8a2
    automated match to d2bw0a2
    complexed with 6dd, btb

Details for d4tt8a1

PDB Entry: 4tt8 (more details), 2.3 Å

PDB Description: crystal structure of the hydrolase domain of 10-formyltetrahydrofolate dehydrogenase (wild-type) complex with 10-formyl-5,8-dideazafolate
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d4tt8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tt8a1 c.65.1.1 (A:1-203) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mkiavigqslfgqevykelkneghmivgvftipdkdgkvdplaieaekdgvpvfkfprwr
lkgkaitevvdqykavgaelnvlpfcsqfipmevidhpkhgsiiyhpsllprhrgasain
wtlihgdkkggftvfwaddgldtgpillqrecdvepndnvnsiykrflfpegvkgmveav
rliatgkaprikqpeegatyeci

SCOPe Domain Coordinates for d4tt8a1:

Click to download the PDB-style file with coordinates for d4tt8a1.
(The format of our PDB-style files is described here.)

Timeline for d4tt8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tt8a2