Lineage for d1bbpb_ (1bbp B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324278Protein Bilin-binding protein [50837] (1 species)
  7. 1324279Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)
  8. 1324286Domain d1bbpb_: 1bbp B: [27148]
    complexed with blv

Details for d1bbpb_

PDB Entry: 1bbp (more details), 2 Å

PDB Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.
PDB Compounds: (B:) bilin binding protein

SCOPe Domain Sequences for d1bbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbpb_ b.60.1.1 (B:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn

SCOPe Domain Coordinates for d1bbpb_:

Click to download the PDB-style file with coordinates for d1bbpb_.
(The format of our PDB-style files is described here.)

Timeline for d1bbpb_: