SCOPe 2.07: Domain d4xqod_: 4xqo D:

Lineage for d4xqod_ (4xqo D:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)

8. Domain d4xqod_: 4xqo D: [271099]
   Other proteins in same PDB: d4xqoa_, d4xqoc_, d4xqoe_
   automated match to d4uo4b_
   complexed with gal, nag, sia

Details for d4xqod_

PDB Entry: 4xqo, 2.85 Å

PDB Description: crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-sln

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xqod_:

Sequence, based on SEQRES records:

>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records):

>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwyfrhqnaqgtgqaadykstqaaidqitgklnrlventefe
siesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrk
qlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d4xqod_:

• d4xqod_ first appeared in SCOPe 2.05
  
• d4xqod_ appears in SCOPe 2.06
  
• d4xqod_ appears in the current release, SCOPe 2.08