Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries) |
Domain d4xqod_: 4xqo D: [271099] Other proteins in same PDB: d4xqoa_, d4xqoc_, d4xqoe_ automated match to d4uo4b_ complexed with gal, nag, sia |
PDB Entry: 4xqo (more details), 2.85 Å
SCOPe Domain Sequences for d4xqod_:
Sequence, based on SEQRES records: (download)
>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]} lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]} lfgaiagflengwegmvdgwyfrhqnaqgtgqaadykstqaaidqitgklnrlventefe siesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrk qlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d4xqod_: