Lineage for d4q5qb1 (4q5q B:2-87)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487514Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [270996] (1 PDB entry)
  8. 2487516Domain d4q5qb1: 4q5q B:2-87 [271009]
    Other proteins in same PDB: d4q5qa2, d4q5qb2
    automated match to d2fhea2
    complexed with gsh

Details for d4q5qb1

PDB Entry: 4q5q (more details), 1.93 Å

PDB Description: crystal structure of the glutathione s-transferase der p 8
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4q5qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5qb1 c.47.1.0 (B:2-87) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
sqpilgywdirgyaqpirllltysgvdfvdkryqigpapdfdrsewlnekfnlgldfpnl
pyyidgdmkmtqtfailrylgrkykl

SCOPe Domain Coordinates for d4q5qb1:

Click to download the PDB-style file with coordinates for d4q5qb1.
(The format of our PDB-style files is described here.)

Timeline for d4q5qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q5qb2