Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [270996] (1 PDB entry) |
Domain d4q5qb1: 4q5q B:2-87 [271009] Other proteins in same PDB: d4q5qa2, d4q5qb2 automated match to d2fhea2 complexed with gsh |
PDB Entry: 4q5q (more details), 1.93 Å
SCOPe Domain Sequences for d4q5qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5qb1 c.47.1.0 (B:2-87) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} sqpilgywdirgyaqpirllltysgvdfvdkryqigpapdfdrsewlnekfnlgldfpnl pyyidgdmkmtqtfailrylgrkykl
Timeline for d4q5qb1: