Lineage for d1a3wb1 (1a3w B:88-188)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564227Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 564228Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 564229Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 564230Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 564231Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50806] (2 PDB entries)
  8. 564233Domain d1a3wb1: 1a3w B:88-188 [27061]
    Other proteins in same PDB: d1a3wa2, d1a3wa3, d1a3wb2, d1a3wb3
    complexed with fbp, k, mn, pga

Details for d1a3wb1

PDB Entry: 1a3w (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with fbp, pg, mn2+ and k+

SCOP Domain Sequences for d1a3wb1:

Sequence, based on SEQRES records: (download)

>d1a3wb1 b.58.1.1 (B:88-188) Pyruvate kinase (PK) {Baker's yeast (Saccharomyces cerevisiae)}
peirtgtttndvdypippnhemifttddkyakacddkimyvdyknitkvisagriiyvdd
gvlsfqvlevvddktlkvkalnagkicshkgvnlpgtdvdl

Sequence, based on observed residues (ATOM records): (download)

>d1a3wb1 b.58.1.1 (B:88-188) Pyruvate kinase (PK) {Baker's yeast (Saccharomyces cerevisiae)}
peirtgtttndpippnhemifttddkyakacddkimyvdyknitkvisagriiyvddgvl
sfqvlevvdtlkvkalnagkicshkgvnlpgtdvdl

SCOP Domain Coordinates for d1a3wb1:

Click to download the PDB-style file with coordinates for d1a3wb1.
(The format of our PDB-style files is described here.)

Timeline for d1a3wb1: