SCOPe 2.07: Domain d4po9a2: 4po9 A:270-329

Lineage for d4po9a2 (4po9 A:270-329)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
   alpha-beta(3)-alpha(2); 2 layers, alpha/beta

4. Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families)

5. Family d.48.1.0: automated matches [227236] (1 protein)
   not a true family

6. Protein automated matches [226990] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [270303] (16 PDB entries)

8. Domain d4po9a2: 4po9 A:270-329 [270352]
   Other proteins in same PDB: d4po9a1
   automated match to d2zrma2
   complexed with edo, gol, na

Details for d4po9a2

PDB Entry: 4po9, 2.75 Å

PDB Description: mycobacterium tuberculosis reca glycerol bound low temperature structure iic-br

PDB Compounds: (A:) Protein RecA, 1st part, 2nd part

SCOPe Domain Sequences for d4po9a2:

Sequence; same for both SEQRES and ATOM records:

>d4po9a2 d.48.1.0 (A:270-329) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvadeiekkikeklg

Timeline for d4po9a2:

• d4po9a2 first appeared in SCOPe 2.05
  
• d4po9a2 appears in SCOPe 2.06
  
• d4po9a2 appears in the current release, SCOPe 2.08