Lineage for d4xiwe_ (4xiw E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2422210Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2422211Protein automated matches [191011] (16 species)
    not a true protein
  7. 2422223Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [270125] (2 PDB entries)
  8. 2422228Domain d4xiwe_: 4xiw E: [270143]
    automated match to d3mdza_
    complexed with 2hp, azm, zn

Details for d4xiwe_

PDB Entry: 4xiw (more details), 2.6 Å

PDB Description: carbonic anhydrase cah3 from chlamydomonas reinhardtii in complex with acetazolamide
PDB Compounds: (E:) Carbonic anhydrase, alpha type

SCOPe Domain Sequences for d4xiwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xiwe_ b.74.1.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
aawnygevagpptwkgvcatgkrqspiniplntsapkvdaemgefdfaygsfekcdvlnt
ghgtmqvnfpagnlafignmelellqfhfhapsehamdgrryameahlvhknkstgnlav
lgimlepggliknpalstalevapevplakkpspkginpvmllpkkskagtrpfvhypgs
lttppcsegvdwfvfmqpikvpdsqildfmrfvgdnktyatntrplqllnsrlveyel

SCOPe Domain Coordinates for d4xiwe_:

Click to download the PDB-style file with coordinates for d4xiwe_.
(The format of our PDB-style files is described here.)

Timeline for d4xiwe_: