SCOPe 2.07: Domain d4x7dd1: 4x7d D:1-119

Lineage for d4x7dd1 (4x7d D:1-119)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4x7dd1: 4x7d D:1-119 [270116]
   Other proteins in same PDB: d4x7dd2
   automated match to d4b50a_
   complexed with edo

Details for d4x7dd1

PDB Entry: 4x7d, 2.15 Å

PDB Description: crystal structure of 2012 nsw gii.4 p domain in complex with nano-85

PDB Compounds: (D:) Nano-85 Nanobody

SCOPe Domain Sequences for d4x7dd1:

Sequence; same for both SEQRES and ATOM records:

>d4x7dd1 b.1.1.1 (D:1-119) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlvesggglvqpggslrlscaasgsifsiyamgwyrqapgkqrelvasissgggtnya
dsvkgrftisgdnakntvylqmnslkpedtavyyckredysayappsgsrgrgtqvtvs

Timeline for d4x7dd1:

• d4x7dd1 first appeared in SCOPe 2.05, called d4x7dd_
  
• d4x7dd1 appears in SCOPe 2.06
  
• d4x7dd1 appears in the current release, SCOPe 2.08