SCOPe 2.07: Domain d4wxba_: 4wxb A:

Lineage for d4wxba_ (4wxb A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (25 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:299768] [270038] (8 PDB entries)

8. Domain d4wxba_: 4wxb A: [270046]
   automated match to d1dfoa_
   complexed with cac, cit, gol, na

Details for d4wxba_

PDB Entry: 4wxb, 2.05 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from streptococcus thermophilus

PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4wxba_:

Sequence; same for both SEQRES and ATOM records:

>d4wxba_ c.67.1.4 (A:) automated matches {Streptococcus thermophilus [TaxId: 299768]}
dykafdpelwnaidaeaerqqnnieliasenvvskavmaaqgtlltnkyaegypgkryyg
gtavidvvetlaierakklfgakfanvqphsgsqanaavymsliqpgdtvmgmdlsaggh
lthgapvsfsgktynfvsynvdkeselldydailaqakevrpklivagasaysriidfak
freiadavgaylmvdmahiaglvasghhpspvpyahvttttthktlrgprggliltdded
iakklnsavfpglqggplehviaakavalkealdpafkeygenviknaaamadvfnqhpd
frvisggtnnhlflvdvtkvvengkvaqnvleevnitlnknsipyeqlspfktsgirvgs
paitsrgmgeaesrqiaewmvealenhdkpevlerirgdvkvltdafply

Timeline for d4wxba_:

• d4wxba_ first appeared in SCOPe 2.05
  
• d4wxba_ appears in SCOPe 2.06
  
• d4wxba_ appears in the current release, SCOPe 2.08