Lineage for d4w8nd_ (4w8n D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645873Domain d4w8nd_: 4w8n D: [269968]
    Other proteins in same PDB: d4w8na1, d4w8na2, d4w8nc1, d4w8nc2, d4w8ne_
    automated match to d3gbmb_
    complexed with nag, ndg

Details for d4w8nd_

PDB Entry: 4w8n (more details), 2.9 Å

PDB Description: the crystal structure of hemagglutinin from a swine influenza virus (a/swine/missouri/2124514/2006)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4w8nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w8nd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkaidgitnkvnsviekmn
tqfeavgkefnnlerrlenlnkkmedgfidvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnakeigngcfefyhkcddecmnsvrngtydyikyeeesklnrne

SCOPe Domain Coordinates for d4w8nd_:

Click to download the PDB-style file with coordinates for d4w8nd_.
(The format of our PDB-style files is described here.)

Timeline for d4w8nd_: