SCOPe 2.08: Domain d4x6cg1: 4x6c G:1-113

Lineage for d4x6cg1 (4x6c G:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4x6cg1: 4x6c G:1-113 [269570]
   Other proteins in same PDB: d4x6ca1, d4x6ca2, d4x6cb_, d4x6cc1, d4x6cd_, d4x6ce2, d4x6cg2
   automated match to d2pyfa1
   complexed with 42h, nag

Details for d4x6cg1

PDB Entry: 4x6c, 2.8 Å

PDB Description: cd1a ternary complex with lysophosphatidylcholine and bk6 tcr

PDB Compounds: (G:) tcr alpha

SCOPe Domain Sequences for d4x6cg1:

Sequence; same for both SEQRES and ATOM records:

>d4x6cg1 b.1.1.0 (G:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrf
taqvdksskyislfirdsqpsdsatylcamstslpnagkstfgdgttltvkpn

Timeline for d4x6cg1:

• d4x6cg1 first appeared in SCOPe 2.05
  
• d4x6cg1 appears in SCOPe 2.07