Lineage for d1mai__ (1mai -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins) 
Protein Phospholipase C delta-1 [50731] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50732] (1 PDB entry) 
Domain d1mai__: 1mai - [26951]
Details for d1mai__
PDB Entry: 1mai (more details), 1.9 Å
PDB Description: structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
SCOP Domain Sequences for d1mai__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mai__ b.55.1.1 (-) Phospholipase C delta-1 {Rat (Rattus norvegicus)}
glqddpdlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlfsied
iqevrmghrteglekfardipedrcfsivfkdqrntldliapspadaqhwvqglrkiih
SCOP Domain Coordinates for d1mai__:
Click to download the PDB-style file with coordinates for d1mai__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mai__:
- d1mai__ appears in SCOP 1.57
- d1mai__ appears in the current release, SCOPe 2.08, called d1maia_
View in 3D