PDB entry 1mai

View 1mai on RCSB PDB site
Description: structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
Deposited on 1996-05-23, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1mai__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mai_ (-)
  glqddpdlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlfsied
  iqevrmghrteglekfardipedrcfsivfkdqrntldliapspadaqhwvqglrkiih