Lineage for d4u3ga_ (4u3g A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314572Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2314687Species Escherichia coli [TaxId:199310] [268908] (1 PDB entry)
  8. 2314688Domain d4u3ga_: 4u3g A: [268923]
    automated match to d3e1ja_
    complexed with so4; mutant

Details for d4u3ga_

PDB Entry: 4u3g (more details), 2 Å

PDB Description: crystal structure of escherichia coli bacterioferritin mutant d132f
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4u3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u3ga_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 199310]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghifwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d4u3ga_:

Click to download the PDB-style file with coordinates for d4u3ga_.
(The format of our PDB-style files is described here.)

Timeline for d4u3ga_: