SCOPe 2.08: Domain d4rgos2: 4rgo S:122-238

Lineage for d4rgos2 (4rgo S:122-238)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d4rgos2: 4rgo S:122-238 [268736]
   Other proteins in same PDB: d4rgoh_, d4rgol1, d4rgol2, d4rgos1
   automated match to d1se4a2
   complexed with act

Details for d4rgos2

PDB Entry: 4rgo, 1.8 Å

PDB Description: structure of staphylococcal enterotoxin b bound to the neutralizing antibody 14g8

PDB Compounds: (S:) enterotoxin type b

SCOPe Domain Sequences for d4rgos2:

Sequence; same for both SEQRES and ATOM records:

>d4rgos2 d.15.6.1 (S:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d4rgos2:

• d4rgos2 first appeared in SCOPe 2.05
  
• d4rgos2 appears in SCOPe 2.07