Lineage for d1cms__ (1cms -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) 
Protein Chymosin (synonim: renin) [50667] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [50668] (4 PDB entries) 
Domain d1cms__: 1cms - [26867]
Details for d1cms__
PDB Entry: 1cms (more details), 2.3 Å
PDB Description: the three-dimensional structure of recombinant bovine chymosin at 2.3 angstroms resolution
SCOP Domain Sequences for d1cms__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cms__ b.50.1.2 (-) Chymosin (synonim: renin) {Cow (Bos taurus)}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai
SCOP Domain Coordinates for d1cms__:
Click to download the PDB-style file with coordinates for d1cms__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cms__:
- d1cms__ first appeared (with stable ids) in SCOP 1.55
- d1cms__ appears in SCOP 1.57
- d1cms__ appears in SCOP 1.61
- d1cms__ appears in the current release, SCOPe 2.08, called d1cmsa_
View in 3D