Lineage for d4oe7b_ (4oe7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444855Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)
  8. 2444877Domain d4oe7b_: 4oe7 B: [268506]
    automated match to d2v9da_
    complexed with edo, gol, gxp, gxs, gxt, mg, pyr

Details for d4oe7b_

PDB Entry: 4oe7 (more details), 1.99 Å

PDB Description: crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
PDB Compounds: (B:) Probable 2-keto-3-deoxy-galactonate aldolase YagE

SCOPe Domain Sequences for d4oe7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oe7b_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

SCOPe Domain Coordinates for d4oe7b_:

Click to download the PDB-style file with coordinates for d4oe7b_.
(The format of our PDB-style files is described here.)

Timeline for d4oe7b_: