![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries) |
![]() | Domain d4oe7b_: 4oe7 B: [268506] automated match to d2v9da_ complexed with edo, gol, gxp, gxs, gxt, mg, pyr |
PDB Entry: 4oe7 (more details), 1.99 Å
SCOPe Domain Sequences for d4oe7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oe7b_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
Timeline for d4oe7b_: