Lineage for d1psaa_ (1psa A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2411615Protein Pepsin(ogen) [50658] (4 species)
  7. 2411628Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries)
  8. 2411640Domain d1psaa_: 1psa A: [26846]
    complexed with 0zl

Details for d1psaa_

PDB Entry: 1psa (more details), 2.9 Å

PDB Description: structure of a pepsin(slash)renin inhibitor complex reveals a novel crystal packing induced by minor chemical alterations in the inhibitor
PDB Compounds: (A:) pepsin a

SCOPe Domain Sequences for d1psaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psaa_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOPe Domain Coordinates for d1psaa_:

Click to download the PDB-style file with coordinates for d1psaa_.
(The format of our PDB-style files is described here.)

Timeline for d1psaa_: