![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (25 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [268117] (1 PDB entry) |
![]() | Domain d3x15g_: 3x15 G: [268123] automated match to d2zxya_ complexed with hec |
PDB Entry: 3x15 (more details), 1.6 Å
SCOPe Domain Sequences for d3x15g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x15g_ a.3.1.0 (G:) automated matches {Aquifex aeolicus [TaxId: 224324]} adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai mkpqltmlkglsdaelkaladfilshk
Timeline for d3x15g_: