Class b: All beta proteins [48724] (165 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species) |
Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries) |
Domain d5fiva_: 5fiv A: [26765] complexed with inh |
PDB Entry: 5fiv (more details), 1.9 Å
SCOP Domain Sequences for d5fiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} gttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigigggkr gtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm
Timeline for d5fiva_: