SCOP 1.73: Domain d1fiva_: 1fiv A:

Lineage for d1fiva_ (1fiv A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)

8. Domain d1fiva_: 1fiv A: [26764]
   complexed with nh2, npy, sta

Details for d1fiva_

PDB Entry: 1fiv, 2 Å

PDB Description: structure of an inhibitor complex of proteinase from feline immunodeficiency virus

PDB Compounds: (A:) FIV Protease

SCOP Domain Sequences for d1fiva_:

Sequence; same for both SEQRES and ATOM records:

>d1fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]}
vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

Timeline for d1fiva_:

• d1fiva_ first appeared (with stable ids) in SCOP 1.55
  
• d1fiva_ appears in SCOP 1.71
  
• d1fiva_ appears in SCOP 1.75
  
• d1fiva_ appears in the current release, SCOPe 2.08