PDB entry 1fiv

View 1fiv on RCSB PDB site
Description: structure of an inhibitor complex of proteinase from feline immunodeficiency virus
Class: hydrolase (acid proteinase)
Keywords: hydrolase (acid proteinase)
Deposited on 1995-05-04, released 1995-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FIV Protease
  Species: Feline immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16088 (0-112)
  Domains in SCOP 1.73: d1fiva_
• Chain 'B':
  Compound: fiv protease inhibitor lp-149
  
• Heterogens: ACE, NH2, NPY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fivA (A:)
  vgttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggk
  rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm
  

  
  
• Chain 'B':
  No sequence available.