SCOP 1.73: Domain d1ythb_: 1yth B:

Lineage for d1ythb_ (1yth B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1ythb_: 1yth B: [26753]
   complexed with ace; mutant

Details for d1ythb_

PDB Entry: 1yth, 2.2 Å

PDB Description: siv protease crystallized with peptide product

PDB Compounds: (B:) hiv protease

SCOP Domain Sequences for d1ythb_:

Sequence; same for both SEQRES and ATOM records:

>d1ythb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1ythb_:

• d1ythb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ythb_ appears in SCOP 1.71
  
• d1ythb_ appears in SCOP 1.75
  
• d1ythb_ appears in the current release, SCOPe 2.08