Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (3 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) |
Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries) |
Domain d1ythb_: 1yth B: [26753] complexed with ace; mutant |
PDB Entry: 1yth (more details), 2.2 Å
SCOP Domain Sequences for d1ythb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ythb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipveicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d1ythb_: