SCOP 1.57: Domain d1ytgb_: 1ytg B:

Lineage for d1ytgb_ (1ytg B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (10 PDB entries)

8. Domain d1ytgb_: 1ytg B: [26751]

Details for d1ytgb_

PDB Entry: 1ytg, 2.3 Å

PDB Description: siv protease crystallized with peptide product

SCOP Domain Sequences for d1ytgb_:

Sequence; same for both SEQRES and ATOM records:

>d1ytgb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1ytgb_:

• d1ytgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ytgb_ appears in SCOP 1.59
  
• d1ytgb_ appears in the current release, SCOPe 2.08