SCOPe 2.07: Domain d4uvab2: 4uva B:376-440

Lineage for d4uvab2 (4uva B:376-440)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d4uvab2: 4uva B:376-440 [267493]
   Other proteins in same PDB: d4uvaa1, d4uvaa2, d4uvaa3, d4uvab1
   complexed with d73

Details for d4uvab2

PDB Entry: 4uva, 2.9 Å

PDB Description: LSD1(KDM1A)-CoREST in complex with 1-Methyl-Tranylcypromine (1R,2S)

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d4uvab2:

Sequence; same for both SEQRES and ATOM records:

>d4uvab2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

Timeline for d4uvab2:

• d4uvab2 first appeared in SCOPe 2.05
  
• d4uvab2 appears in SCOPe 2.06
  
• d4uvab2 appears in the current release, SCOPe 2.08