Class b: All beta proteins [48724] (178 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (35 PDB entries) |
Domain d4qaac1: 4qaa C:1-205 [267283] Other proteins in same PDB: d4qaaa2, d4qaab2, d4qaac2, d4qaad2, d4qaae2, d4qaaf2, d4qaag2, d4qaah2, d4qaai2, d4qaaj2 automated match to d4alxa_ complexed with kk1, nag, po4 |
PDB Entry: 4qaa (more details), 2.7 Å
SCOPe Domain Sequences for d4qaac1:
Sequence, based on SEQRES records: (download)
>d4qaac1 b.96.1.1 (C:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkg
>d4qaac1 b.96.1.1 (C:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtpeayedvevslnfrkkg
Timeline for d4qaac1: