Lineage for d4otlb_ (4otl B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2504021Protein automated matches [190152] (25 species)
    not a true protein
  7. 2504038Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries)
  8. 2504050Domain d4otlb_: 4otl B: [267134]
    Other proteins in same PDB: d4otld2
    automated match to d4n0wa_
    complexed with edo, gly, plp

Details for d4otlb_

PDB Entry: 4otl (more details), 2 Å

PDB Description: X-ray Crystal Structure of Serine Hydroxymethyl Transferase from Burkholderia cenocepacia bound to PLP and Glycine
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4otlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otlb_ c.67.1.4 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
stianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegypgkryy
ggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgmslahgg
hlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafalkidfer
lakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvilmkaey
ekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetlvkrglr
ivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgirlgspa
mttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvyr

SCOPe Domain Coordinates for d4otlb_:

Click to download the PDB-style file with coordinates for d4otlb_.
(The format of our PDB-style files is described here.)

Timeline for d4otlb_: