![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein automated matches [190152] (25 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries) |
![]() | Domain d4otlb_: 4otl B: [267134] Other proteins in same PDB: d4otld2 automated match to d4n0wa_ complexed with edo, gly, plp |
PDB Entry: 4otl (more details), 2 Å
SCOPe Domain Sequences for d4otlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4otlb_ c.67.1.4 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} stianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegypgkryy ggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgmslahgg hlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafalkidfer lakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvilmkaey ekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetlvkrglr ivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgirlgspa mttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvyr
Timeline for d4otlb_:
![]() Domains from other chains: (mouse over for more information) d4otla_, d4otlc_, d4otld1, d4otld2 |