SCOPe 2.08: Domain d4orgf1: 4org F:3-107

Lineage for d4orgf1 (4org F:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4orgf1: 4org F:3-107 [267090]
   Other proteins in same PDB: d4orga_, d4orgb2, d4orgc_, d4orgd2, d4orge_, d4orgf2, d4orgh_, d4orgl2
   automated match to d3zl4l1

Details for d4orgf1

PDB Entry: 4org, 3.12 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.04, a potent V1V2-directed HIV-1 neutralizing antibody

PDB Compounds: (F:) CAP256-VRC26.04 light chain

SCOPe Domain Sequences for d4orgf1:

Sequence, based on SEQRES records:

>d4orgf1 b.1.1.0 (F:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnignnfvswyqqrpgtapslliyetnkrpsgipdr
fsgsksatsatlaitglqtgdeadyycatwaasltsarvfgtgtkvivsg

Sequence, based on observed residues (ATOM records):

>d4orgf1 b.1.1.0 (F:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnignnfvswyqqrpgtapslliyetnkrpsgipdr
fsgsksatsatlaitglqtgdeadyycatwaaslvfgtgtkvivsg

Timeline for d4orgf1:

• d4orgf1 first appeared in SCOPe 2.05
  
• d4orgf1 appears in SCOPe 2.07