Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries) |
Domain d4ls8a2: 4ls8 A:252-413 [266693] Other proteins in same PDB: d4ls8a3, d4ls8b3 automated match to d2alma2 complexed with 1xg, cl, edo, na |
PDB Entry: 4ls8 (more details), 2.1 Å
SCOPe Domain Sequences for d4ls8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ls8a2 c.95.1.0 (A:252-413) automated matches {Bacillus subtilis [TaxId: 224308]} kiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyinahgtstyynd kyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikegvipptiniqtp deecdldyvpdearrqelnyvlsnslgfgghnatlifkkyqs
Timeline for d4ls8a2: