Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries) |
Domain d4kt2f1: 4kt2 F:4-113 [266588] Other proteins in same PDB: d4kt2a2, d4kt2a3, d4kt2b2, d4kt2b3, d4kt2c2, d4kt2c3, d4kt2d2, d4kt2d3, d4kt2e2, d4kt2e3, d4kt2f2, d4kt2f3, d4kt2g2, d4kt2g3, d4kt2h2, d4kt2h3 automated match to d4il2a1 complexed with cl, gol, mg, so4 |
PDB Entry: 4kt2 (more details), 1.8 Å
SCOPe Domain Sequences for d4kt2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt2f1 d.54.1.0 (F:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d4kt2f1: