Lineage for d4k2sd1 (4k2s D:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948105Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2948118Domain d4k2sd1: 4k2s D:4-113 [266502]
    Other proteins in same PDB: d4k2sa2, d4k2sa3, d4k2sb2, d4k2sb3, d4k2sc2, d4k2sc3, d4k2sd2, d4k2sd3, d4k2se2, d4k2se3, d4k2sf2, d4k2sf3, d4k2sg2, d4k2sg3, d4k2sh2, d4k2sh3
    automated match to d4il2a1
    complexed with cl, gco, gol, mg; mutant

Details for d4k2sd1

PDB Entry: 4k2s (more details), 1.7 Å

PDB Description: crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
PDB Compounds: (D:) D-mannonate dehydratase

SCOPe Domain Sequences for d4k2sd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2sd1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d4k2sd1:

Click to download the PDB-style file with coordinates for d4k2sd1.
(The format of our PDB-style files is described here.)

Timeline for d4k2sd1: