![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries) |
![]() | Domain d4k2sc1: 4k2s C:4-113 [266500] Other proteins in same PDB: d4k2sa2, d4k2sa3, d4k2sb2, d4k2sb3, d4k2sc2, d4k2sc3, d4k2sd2, d4k2sd3, d4k2se2, d4k2se3, d4k2sf2, d4k2sf3, d4k2sg2, d4k2sg3, d4k2sh2, d4k2sh3 automated match to d4il2a1 complexed with cl, gco, gol, mg; mutant |
PDB Entry: 4k2s (more details), 1.7 Å
SCOPe Domain Sequences for d4k2sc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2sc1 d.54.1.0 (C:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d4k2sc1: