![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries) |
![]() | Domain d4k2sa2: 4k2s A:114-405 [266497] Other proteins in same PDB: d4k2sa1, d4k2sa3, d4k2sb1, d4k2sb3, d4k2sc1, d4k2sc3, d4k2sd1, d4k2sd3, d4k2se1, d4k2se3, d4k2sf1, d4k2sf3, d4k2sg1, d4k2sg3, d4k2sh1, d4k2sh3 automated match to d4il2a2 complexed with cl, gco, gol, mg; mutant |
PDB Entry: 4k2s (more details), 1.7 Å
SCOPe Domain Sequences for d4k2sa2:
Sequence, based on SEQRES records: (download)
>d4k2sa2 c.1.11.0 (A:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryep adsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepy hlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgg gitamrrvadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdav fphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
>d4k2sa2 c.1.11.0 (A:114-405) automated matches {Chromohalobacter salexigens [TaxId: 290398]} ksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvasslpaehvw stekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpa enqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadl aslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedgh flagespghgvdideelaakypyeraslpvnrledgtlwhw
Timeline for d4k2sa2: